SCOP 1.73: Domain d2cnwd1: 2cnw D:21-78

Lineage for d2cnwd1 (2cnw D:21-78)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal recognition particle receptor, FtsY [47368] (3 species)

7. Species Thermus aquaticus [TaxId:271] [101122] (5 PDB entries)

8. Domain d2cnwd1: 2cnw D:21-78 [130655]
   Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd2, d2cnwe2, d2cnwf2
   automatically matched to d1okkd1
   complexed with 5gp, alf, gdp, mg

Details for d2cnwd1

PDB Entry: 2cnw, 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy

PDB Compounds: (D:) cell division protein ftsy

SCOP Domain Sequences for d2cnwd1:

Sequence; same for both SEQRES and ATOM records:

>d2cnwd1 a.24.13.1 (D:21-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
aipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

Timeline for d2cnwd1:

• d2cnwd1 is new in SCOP 1.73
  
• d2cnwd1 appears in SCOP 1.75
  
• d2cnwd1 appears in the current release, SCOPe 2.08