SCOPe 2.08: Domain d7nhpe_: 7nhp E:

Lineage for d7nhpe_ (7nhp E:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161048] (7 PDB entries)
   Uniprot Q8DIP0 3-84

8. Domain d7nhpe_: 7nhp E: [403752]
   Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpd_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_
   automated match to d2axte1
   complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9
   has additional insertions and/or extensions that are not grouped together

Details for d7nhpe_

PDB Entry: 7nhp, 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)

PDB Compounds: (E:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d7nhpe_:

Sequence; same for both SEQRES and ATOM records:

>d7nhpe_ f.23.38.1 (E:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus elongatus [TaxId: 146786]}
rpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsiplvt
drfeakqqvetfleqlk

Timeline for d7nhpe_:

• d7nhpe_ first appeared in SCOPe 2.07