SCOPe 2.08: Domain d7nhpk_: 7nhp K:

Lineage for d7nhpk_ (7nhp K:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families)
   automatically mapped to Pfam PF02533

5. Family f.23.36.1: PsbK-like [161038] (2 proteins)
   Pfam PF02533

6. Protein automated matches [339417] (5 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [400106] (4 PDB entries)

8. Domain d7nhpk_: 7nhp K: [403830]
   Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_
   automated match to d5h2fk_
   complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhpk_

PDB Entry: 7nhp, 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)

PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d7nhpk_:

Sequence; same for both SEQRES and ATOM records:

>d7nhpk_ f.23.36.1 (K:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

Timeline for d7nhpk_:

• d7nhpk_ first appeared in SCOPe 2.07