![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
![]() | Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) ![]() automatically mapped to Pfam PF00421 |
![]() | Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
![]() | Protein Photosystem II core light harvesting protein PsbB [161079] (2 species) |
![]() | Species Thermosynechococcus elongatus [TaxId:146786] [161080] (7 PDB entries) Uniprot Q8DIQ1 2-489 |
![]() | Domain d7nhpb_: 7nhp B: [403772] Other proteins in same PDB: d7nhpa_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_ automated match to d2axtb1 complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9 |
PDB Entry: 7nhp (more details), 2.72 Å
SCOPe Domain Sequences for d7nhpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nhpb_ f.55.1.1 (B:) Photosystem II core light harvesting protein PsbB {Thermosynechococcus elongatus [TaxId: 146786]} glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg idpelspeqvewgfyq
Timeline for d7nhpb_: