SCOPe 2.08: Domain d7nhpc_: 7nhp C:

Lineage for d7nhpc_ (7nhp C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
   6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops

4. Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family)
   automatically mapped to Pfam PF00421

5. Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
   Pfam PF00421

6. Protein automated matches [191285] (5 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries)

8. Domain d7nhpc_: 7nhp C: [403749]
   Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_
   automated match to d5b66c_
   complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhpc_

PDB Entry: 7nhp, 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)

PDB Compounds: (C:) Photosystem II CP43 reaction center protein

SCOPe Domain Sequences for d7nhpc_:

Sequence; same for both SEQRES and ATOM records:

>d7nhpc_ f.55.1.1 (C:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
rdqessgfawwagnarlinlsgkllgahvahaglivfwagamtlfelahfipekpmyeqg
liliphiatlgwgvgpggevvdtfpffvvgvvhlissavlgfggvyhairgpetleeyss
ffgydwkdknkmttilgfhlivlgigalllvakamffgglydtwapgggdvrvitnptld
prvifgyllkspfggegwivsvnnledvvgghiwigliciaggiwhilttpfgwarrafi
wsgeaylsyslgalsmmgfiatcfvwfnntvypsefygptgpeasqaqamtflirdqklg
anvgsaqgptglgkylmrsptgeiifggetmrfwdfrgpwleplrgpngldlnkikndiq
pwqerraaeymthaplgslnsvggvateinsvnfvsprswlatshfvlaffflvghlwha
graraaaagfek

Timeline for d7nhpc_:

• d7nhpc_ first appeared in SCOPe 2.07