SCOPe 2.08: Domain d7nhpf_: 7nhp F:

Lineage for d7nhpf_ (7nhp F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit beta, PsbF [161049] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161050] (5 PDB entries)
   Uniprot Q8DIN9 11-45

8. Domain d7nhpf_: 7nhp F: [403745]
   Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_
   automated match to d2axtf1
   complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhpf_

PDB Entry: 7nhp, 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d7nhpf_:

Sequence; same for both SEQRES and ATOM records:

>d7nhpf_ f.23.38.1 (F:) Cytochrome b559 subunit beta, PsbF {Thermosynechococcus elongatus [TaxId: 146786]}
qepvsypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d7nhpf_:

• d7nhpf_ first appeared in SCOPe 2.07