SCOPe 2.08: Domain d7nhpm_: 7nhp M:

Lineage for d7nhpm_ (7nhp M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family)
   automatically mapped to Pfam PF05151

5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
   Pfam PF05151

6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)

7. Species Thermosynechococcus elongatus [TaxId:146786] [161036] (11 PDB entries)
   Uniprot Q8DHA7 1-36

8. Domain d7nhpm_: 7nhp M: [403718]
   Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpd_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpt_, d7nhpx_, d7nhpz_
   automated match to d2axtm1
   complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhpm_

PDB Entry: 7nhp, 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)

PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d7nhpm_:

Sequence; same for both SEQRES and ATOM records:

>d7nhpm_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
mevnqlgliatalfvlvpsvfliilyvqtesqqk

Timeline for d7nhpm_:

• d7nhpm_ first appeared in SCOPe 2.07