Lineage for d7nhpd_ (7nhp D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027482Protein Photosystem II reaction center d2 protein PsbD2 [161051] (2 species)
  7. 3027483Species Thermosynechococcus elongatus [TaxId:146786] [161052] (5 PDB entries)
    Uniprot Q8CM25 13-352
  8. 3027487Domain d7nhpd_: 7nhp D: [403717]
    Other proteins in same PDB: d7nhpa_, d7nhpb_, d7nhpc_, d7nhpe_, d7nhpf_, d7nhph_, d7nhpi_, d7nhpk_, d7nhpl_, d7nhpm_, d7nhpt_, d7nhpx_, d7nhpz_
    automated match to d2axtd1
    complexed with bcr, cl, cla, fe, hem, lhg, lmg, mn, pho, pl9

Details for d7nhpd_

PDB Entry: 7nhp (more details), 2.72 Å

PDB Description: structure of psii-i (psii with psb27, psb28, and psb34)
PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d7nhpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nhpd_ f.26.1.1 (D:) Photosystem II reaction center d2 protein PsbD2 {Thermosynechococcus elongatus [TaxId: 146786]}
rgwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegc
nfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfe
iarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnw
tlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanr
fwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpef
etfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOPe Domain Coordinates for d7nhpd_:

Click to download the PDB-style file with coordinates for d7nhpd_.
(The format of our PDB-style files is described here.)

Timeline for d7nhpd_: