Lineage for d6dfxa2 (6dfx A:82-179)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (888 PDB entries)
  8. 3067869Domain d6dfxa2: 6dfx A:82-179 [367931]
    Other proteins in same PDB: d6dfxa1, d6dfxd1, d6dfxg1, d6dfxh1, d6dfxi1, d6dfxj1
    automated match to d5ujta2
    complexed with edo, nag

Details for d6dfxa2

PDB Entry: 6dfx (more details), 2.03 Å

PDB Description: human diabetogenic tcr t1d3 in complex with dq8-p8e9e peptide
PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d6dfxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dfxa2 b.1.1.2 (A:82-179) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atnevpevtvfskspvtlgqpntliclvdnifppvvnitwlsnghsvtegvsetsflsks
dhsffkisyltflpsadeiydckvehwgldepllkhwe

SCOPe Domain Coordinates for d6dfxa2:

Click to download the PDB-style file with coordinates for d6dfxa2.
(The format of our PDB-style files is described here.)

Timeline for d6dfxa2:

  • d6dfxa2 appears in periodic updates to SCOPe 2.07 starting on 2019-04-18