Lineage for d6dfxd1 (6dfx D:1-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 3067653Domain d6dfxd1: 6dfx D:1-81 [367715]
    Other proteins in same PDB: d6dfxa2, d6dfxd2, d6dfxg1, d6dfxg2, d6dfxh1, d6dfxh2, d6dfxi1, d6dfxi2, d6dfxj1, d6dfxj2
    automated match to d5ujta1
    complexed with edo, nag

Details for d6dfxd1

PDB Entry: 6dfx (more details), 2.03 Å

PDB Description: human diabetogenic tcr t1d3 in complex with dq8-p8e9e peptide
PDB Compounds: (D:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d6dfxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dfxd1 d.19.1.0 (D:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfa
ltniavlkhnlncvikrsnsta

SCOPe Domain Coordinates for d6dfxd1:

Click to download the PDB-style file with coordinates for d6dfxd1.
(The format of our PDB-style files is described here.)

Timeline for d6dfxd1:

  • d6dfxd1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-18