Lineage for d6dfxi1 (6dfx I:8-113)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 3067692Domain d6dfxi1: 6dfx I:8-113 [367754]
    Other proteins in same PDB: d6dfxa1, d6dfxa2, d6dfxd1, d6dfxd2, d6dfxg2, d6dfxh2, d6dfxi2, d6dfxj2
    automated match to d2f54d1
    complexed with edo, nag

Details for d6dfxi1

PDB Entry: 6dfx (more details), 2.03 Å

PDB Description: human diabetogenic tcr t1d3 in complex with dq8-p8e9e peptide
PDB Compounds: (I:) T1D3 alpha chain

SCOPe Domain Sequences for d6dfxi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dfxi1 b.1.1.0 (I:8-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgrlrvtldts
kksssllitasraadtasyfcatdagynqggklifgqgtelsvkpn

SCOPe Domain Coordinates for d6dfxi1:

Click to download the PDB-style file with coordinates for d6dfxi1.
(The format of our PDB-style files is described here.)

Timeline for d6dfxi1:

  • d6dfxi1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-18