PDB entry 6dfx

View 6dfx on RCSB PDB site
Description: human diabetogenic TCR T1D3 in complex with DQ8-p8E9E peptide
Class: immune system
Keywords: T cell receptor, type 1 diabetes, autoimmunity, IMMUNE SYSTEM
Deposited on 2018-05-15, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q30069 (0-End)
      • conflict (72)
    Domains in SCOPe 2.07: d6dfxa1, d6dfxa2
  • Chain 'B':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3PYM0 (26-End)
      • expression tag (0-18)
      • expression tag (25)
  • Chain 'D':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q30069 (0-End)
      • conflict (72)
    Domains in SCOPe 2.07: d6dfxd1, d6dfxd2
  • Chain 'E':
    Compound: MHC class II antigen
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot U3PYM0 (26-End)
      • expression tag (0-18)
  • Chain 'G':
    Compound: T1D3 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFX
    Domains in SCOPe 2.07: d6dfxg1, d6dfxg2
  • Chain 'H':
    Compound: T1D3 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFX (0-231)
    Domains in SCOPe 2.07: d6dfxh1, d6dfxh2
  • Chain 'I':
    Compound: T1D3 alpha chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFX
    Domains in SCOPe 2.07: d6dfxi1, d6dfxi2
  • Chain 'J':
    Compound: T1D3 beta chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6DFX (0-End)
    Domains in SCOPe 2.07: d6dfxj1, d6dfxj2
  • Heterogens: NAG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6dfxA (A:)
    ivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfa
    ltniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhwe
    pegglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfxA (A:)
    ivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfa
    ltniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhwe
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6dfxD (D:)
    ivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfa
    ltniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhwe
    pegglvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfxD (D:)
    ivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfa
    ltniavlkhnlncvikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhwe
    

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6dfxG (G:)
    mqqgeedpqalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgr
    lrvtldtskksssllitasraadtasyfcatdagynqggklifgqgtelsvkpniqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfxG (G:)
    qalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgrlrvtldts
    kksssllitasraadtasyfcatdagynqggklifgqgtelsvkpniqnpdpavyqlrds
    kssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacan
    afnnsiipedtffp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6dfxH (H:)
    gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfpg
    rfsgrqfsnsrsemnvstlelgdsalylcassagntiyfgegswltvvedlknvfppeva
    vfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnds
    ryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfxH (H:)
    gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfpg
    rfsgrqfsnsrsemnvstlelgdsalylcassagntiyfgegswltvvedlknvfppeva
    vfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnds
    ryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6dfxI (I:)
    mqqgeedpqalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgr
    lrvtldtskksssllitasraadtasyfcatdagynqggklifgqgtelsvkpniqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfxI (I:)
    qalsiqegenatmncsyktsinnlqwyrqnsgrglvhlilirsnerekhsgrlrvtldts
    kksssllitasraadtasyfcatdagynqggklifgqgtelsvkpniqnpdpavyqlrks
    vclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfacanafnnsi
    ipedtffp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6dfxJ (J:)
    gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfpg
    rfsgrqfsnsrsemnvstlelgdsalylcassagntiyfgegswltvvedlknvfppeva
    vfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnds
    ryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgrad
    

    Sequence, based on observed residues (ATOM records): (download)
    >6dfxJ (J:)
    gvtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfsetqrnkgnfpg
    rfsgrqfsnsrsemnvstlelgdsalylcassagntiyfgegswltvvedlknvfppeva
    vfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpalnds
    ryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra