SCOPe 2.08: Domain d6dfxa1: 6dfx A:1-81

Lineage for d6dfxa1 (6dfx A:1-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d6dfxa1: 6dfx A:1-81 [367930]
   Other proteins in same PDB: d6dfxa2, d6dfxd2, d6dfxg1, d6dfxg2, d6dfxh1, d6dfxh2, d6dfxi1, d6dfxi2, d6dfxj1, d6dfxj2
   automated match to d5ujta1
   complexed with edo, nag

Details for d6dfxa1

PDB Entry: 6dfx, 2.03 Å

PDB Description: human diabetogenic tcr t1d3 in complex with dq8-p8e9e peptide

PDB Compounds: (A:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d6dfxa1:

Sequence; same for both SEQRES and ATOM records:

>d6dfxa1 d.19.1.0 (A:1-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfa
ltniavlkhnlncvikrsnsta

Timeline for d6dfxa1:

• d6dfxa1 first appeared in SCOPe 2.07