Lineage for d5okdc2 (5okd C:261-379)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2580258Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2580259Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2580327Family f.32.1.0: automated matches [254197] (1 protein)
    not a true family
  6. 2580328Protein automated matches [254431] (4 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [254896] (2 PDB entries)
  8. 3047162Domain d5okdc2: 5okd C:261-379 [347224]
    Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
    automated match to d2a06c2
    complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdc2

PDB Entry: 5okd (more details), 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d5okdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okdc2 f.32.1.0 (C:261-379) automated matches {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

SCOPe Domain Coordinates for d5okdc2:

Click to download the PDB-style file with coordinates for d5okdc2.
(The format of our PDB-style files is described here.)

Timeline for d5okdc2:

  • d5okdc2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06