![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
![]() | Protein automated matches [190874] (7 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [254898] (2 PDB entries) |
![]() | Domain d5okde2: 5okd E:70-196 [347234] Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okdg_, d5okdh_, d5okdi_, d5okdj_ automated match to d1bcce1 complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4 |
PDB Entry: 5okd (more details), 3.1 Å
SCOPe Domain Sequences for d5okde2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5okde2 b.33.1.1 (E:70-196) automated matches {Cow (Bos taurus) [TaxId: 9913]} amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts ddmvivg
Timeline for d5okde2: