Lineage for d5okde2 (5okd E:70-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782420Protein automated matches [190874] (7 species)
    not a true protein
  7. 2782442Species Cow (Bos taurus) [TaxId:9913] [254898] (2 PDB entries)
  8. 2782444Domain d5okde2: 5okd E:70-196 [347234]
    Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okdg_, d5okdh_, d5okdi_, d5okdj_
    automated match to d1bcce1
    complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okde2

PDB Entry: 5okd (more details), 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d5okde2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okde2 b.33.1.1 (E:70-196) automated matches {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOPe Domain Coordinates for d5okde2:

Click to download the PDB-style file with coordinates for d5okde2.
(The format of our PDB-style files is described here.)

Timeline for d5okde2: