Lineage for d5okdd1 (5okd D:2-195)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304198Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)
  6. 2304238Protein automated matches [232767] (3 species)
    not a true protein
  7. Species Cow (Bos taurus) [TaxId:9913] [254893] (2 PDB entries)
  8. 3047201Domain d5okdd1: 5okd D:2-195 [347263]
    Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
    automated match to d2a06d1
    complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdd1

PDB Entry: 5okd (more details), 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d5okdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okdd1 a.3.1.3 (D:2-195) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytedea
kalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrarh
ggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatmsq
vakdvctflrwaae

SCOPe Domain Coordinates for d5okdd1:

Click to download the PDB-style file with coordinates for d5okdd1.
(The format of our PDB-style files is described here.)

Timeline for d5okdd1:

  • d5okdd1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06