Lineage for d5okdg_ (5okd G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025949Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 3025950Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 3025951Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 3025971Species Cow (Bos taurus) [TaxId:9913] [81503] (21 PDB entries)
    Uniprot P13271 #SP ! Uniprot P13271
  8. 3025993Domain d5okdg_: 5okd G: [347344]
    Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdh_, d5okdi_, d5okdj_
    automated match to d1be3g_
    complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdg_

PDB Entry: 5okd (more details), 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (G:) Cytochrome b-c1 complex subunit 8

SCOPe Domain Sequences for d5okdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okdg_ f.23.13.1 (G:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
rqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvytw
gtqefekskrknpa

SCOPe Domain Coordinates for d5okdg_:

Click to download the PDB-style file with coordinates for d5okdg_.
(The format of our PDB-style files is described here.)

Timeline for d5okdg_: