Lineage for d5okdb2 (5okd B:236-439)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005156Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 3005157Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 3005465Family d.185.1.0: automated matches [232765] (1 protein)
    not a true family
  6. 3005466Protein automated matches [232766] (2 species)
    not a true protein
  7. 3005531Species Cow (Bos taurus) [TaxId:9913] [254892] (2 PDB entries)
  8. 3005533Domain d5okdb2: 5okd B:236-439 [347221]
    Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
    automated match to d2bccb2
    complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdb2

PDB Entry: 5okd (more details), 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (B:) Cytochrome b-c1 complex subunit 2, mitochondrial

SCOPe Domain Sequences for d5okdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5okdb2 d.185.1.0 (B:236-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

SCOPe Domain Coordinates for d5okdb2:

Click to download the PDB-style file with coordinates for d5okdb2.
(The format of our PDB-style files is described here.)

Timeline for d5okdb2: