SCOPe 2.08: Domain d5okdb2: 5okd B:236-439

Lineage for d5okdb2 (5okd B:236-439)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.0: automated matches [232765] (1 protein)
   not a true family

6. Protein automated matches [232766] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [254892] (2 PDB entries)

8. Domain d5okdb2: 5okd B:236-439 [347221]
   Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
   automated match to d2bccb2
   complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okdb2

PDB Entry: 5okd, 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.

PDB Compounds: (B:) Cytochrome b-c1 complex subunit 2, mitochondrial

SCOPe Domain Sequences for d5okdb2:

Sequence; same for both SEQRES and ATOM records:

>d5okdb2 d.185.1.0 (B:236-439) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatssl
yqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnp
dvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaak
kfvsgrksmaasgnlghtpfidel

Timeline for d5okdb2:

• d5okdb2 first appeared in SCOPe 2.07