![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein automated matches [254430] (2 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [254891] (2 PDB entries) |
![]() | Domain d5okdb1: 5okd B:20-235 [347220] Other proteins in same PDB: d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde1, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_ automated match to d1bccb1 complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4 |
PDB Entry: 5okd (more details), 3.1 Å
SCOPe Domain Sequences for d5okdb1:
Sequence, based on SEQRES records: (download)
>d5okdb1 d.185.1.1 (B:20-235) automated matches {Cow (Bos taurus) [TaxId: 9913]} hpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkg assfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaa lqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhf tsarmaliglgvshpvlkqvaeqflnirgglglsga
>d5okdb1 d.185.1.1 (B:20-235) automated matches {Cow (Bos taurus) [TaxId: 9913]} hpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkg assfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaa lqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhf tsarmaliglgvshpvlkqvaeqflnirgga
Timeline for d5okdb1: