SCOPe 2.07: Domain d5okde1: 5okd E:1-69

Lineage for d5okde1 (5okd E:1-69)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [254897] (2 PDB entries)

8. Domain d5okde1: 5okd E:1-69 [347233]
   Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
   automated match to d1bcce2
   complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4

Details for d5okde1

PDB Entry: 5okd, 3.1 Å

PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.

PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d5okde1:

Sequence; same for both SEQRES and ATOM records:

>d5okde1 f.23.12.0 (E:1-69) automated matches {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d5okde1:

• d5okde1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-06