![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) ![]() |
![]() | Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
![]() | Protein automated matches [254432] (4 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [254897] (2 PDB entries) |
![]() | Domain d5okde1: 5okd E:1-69 [347233] Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_ automated match to d1bcce2 complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4 |
PDB Entry: 5okd (more details), 3.1 Å
SCOPe Domain Sequences for d5okde1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5okde1 f.23.12.0 (E:1-69) automated matches {Cow (Bos taurus) [TaxId: 9913]} shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs smsasadvl
Timeline for d5okde1: