Lineage for d5okde1 (5okd E:1-69)
- Root: SCOPe 2.07
Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) 
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) 
Family f.23.12.0: automated matches [254198] (1 protein)
not a true familyProtein automated matches [254432] (4 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [254897] (2 PDB entries) 
Domain d5okde1: 5okd E:1-69 [347233]
Other proteins in same PDB: d5okda1, d5okda2, d5okdb1, d5okdb2, d5okdc1, d5okdc2, d5okdd1, d5okdd2, d5okde2, d5okdg_, d5okdh_, d5okdi_, d5okdj_
automated match to d1bcce2
complexed with 6pe, 9xe, cdl, fes, hec, hem, lmt, pee, pg4, po4, px4
Details for d5okde1
PDB Entry: 5okd (more details), 3.1 Å
PDB Description: crystal structure of bovine cytochrome bc1 in complex with inhibitor scr0911.
PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrialSCOPe Domain Sequences for d5okde1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5okde1 f.23.12.0 (E:1-69) automated matches {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl
SCOPe Domain Coordinates for d5okde1:
Click to download the PDB-style file with coordinates for d5okde1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5okde1:
View in 3D
