PDB entry 5okd

View 5okd on RCSB PDB site
Description: Crystal structure of bovine Cytochrome bc1 in complex with inhibitor SCR0911.
Class: electron transport
Keywords: ELECTRON TRANSPORT, antimalarial inhibitor, Qi site binder
Deposited on 2017-07-25, released 2018-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b-c1 complex subunit 1, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31800 (Start-479)
      • conflict (259-260)
    Domains in SCOPe 2.07: d5okda1, d5okda2
  • Chain 'B':
    Compound: Cytochrome b-c1 complex subunit 2, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okdb1, d5okdb2
  • Chain 'C':
    Compound: cytochrome b
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okdc1, d5okdc2
  • Chain 'D':
    Compound: Cytochrome c1, heme protein, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okdd1, d5okdd2
  • Chain 'E':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okde1, d5okde2
  • Chain 'F':
    Compound: Cytochrome b-c1 complex subunit 7
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00129
      • conflict (56)
  • Chain 'G':
    Compound: Cytochrome b-c1 complex subunit 8
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okdg_
  • Chain 'H':
    Compound: cytochrome b-c1 complex subunit 6, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okdh_
  • Chain 'I':
    Compound: Cytochrome b-c1 complex subunit Rieske, mitochondrial
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okdi_
  • Chain 'J':
    Compound: Cytochrome b-c1 complex subunit 9
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okdj_
  • Heterogens: PG4, 6PE, CDL, HEM, 9XE, LMT, PEE, HEC, PO4, FES, PX4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5okdA (A:)
    maasavcraagagtrvllrtrrspallrssdlrgtatyaqalqsvpetqvsqldnglrva
    seqssqptctvgvwidagsryeseknngagyfvehlafkgtknrpgnalekevesmgahl
    naystrehtayyikalskdlpkavelladivqncsledsqiekerdvilqelqendtsmr
    dvvfnylhatafqgtplaqsvegpsenvrklsradlteylsrhykaprmvlaaagglehr
    qlldlaqkhfsglsgtydeetvptlspcrftgsqichredglplahvaiavegpgwahpd
    nvalqvanaiighydctygggahlssplasiaatnklcqsfqtfnicyadtgllgahfvc
    dhmsiddmmfvlqgqwmrlctsatesevlrgknllrnalvshldgttpvcedigrsllty
    grriplaewesriaevdarvvrevcskyfydqcpavagfgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okdA (A:)
    atyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfveh
    lafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqncs
    ledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsrad
    lteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydeetvptlspcrftgsqi
    chredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaatn
    klcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknll
    rnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcpa
    vagfgpieqlpdynrirsgmfwlrf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5okdB (B:)
    mklltragslsrfyslkvapkvkateapagvpphpqdleftrlpnglviaslenyapasr
    iglfikagsryensnnlgtshllrlasslttkgassfkitrgieavggklsvtstrenma
    ytveclrddvdilmefllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaa
    ayrnalanslycpdyrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflni
    rgglglsgakakyhggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvk
    rgsnatsslyqavakgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvkt
    iaqgnlsnpdvqaaknklkagylmsvessegfldevgsqalaagsytppstvlqqidava
    dadvinaakkfvsgrksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okdB (B:)
    hpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslttkg
    assfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwevaa
    lqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvqnhf
    tsarmaliglgvshpvlkqvaeqflnirggakakyhggeireqngdslvhaalvaesaai
    gsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnasysdsglfgf
    ytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvessegfldevgs
    qalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpfidel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5okdC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okdC (C:)
    tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
    afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
    tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
    hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
    lvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsilil
    alipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfll
    ilvlmptagtienkllkw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5okdD (D:)
    maaaaatlrgamvgprgaglpgarargllcgarpgqlplrtpqavslssksglsrgrkvi
    lsalgmlaaggaglavalhsavsasdlelhppsypwshrgllssldhtsirrgfqvykqv
    csschsmdyvayrhlvgvcytedeakalaeevevqdgpnedgemfmrpgklsdyfpkpyp
    npeaaraanngalppdlsyivrarhggedyvfslltgycepptgvslreglyfnpyfpgq
    aigmappiynevlefddgtpatmsqvakdvctflrwaaepehdhrkrmglkmllmmglll
    plvyamkrhkwsvlksrklayrppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okdD (D:)
    dlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytedea
    kalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrarh
    ggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatmsq
    vakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5okdE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5okdG (G:)
    mgrqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvy
    twgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okdG (G:)
    rqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvytw
    gtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5okdH (H:)
    mgledeqrmltgsgdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssr
    sqteedcteelldflhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okdH (H:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
    lfnsl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5okdI (I:)
    aavpatsespvldlkrsvlcreslrgqaagrplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okdI (I:)
    avpatsespvldlkrsvlcreslrgqaagrplvasvslnvpasvry
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5okdJ (J:)
    mvaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhky
    enke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okdJ (J:)
    aptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye