SCOPe 2.08: Domain d5ws6f_: 5ws6 F:

Lineage for d5ws6f_ (5ws6 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189914] (16 PDB entries)

8. Domain d5ws6f_: 5ws6 F: [331587]
   Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_
   automated match to d2axtf1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6f_

PDB Entry: 5ws6, 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset

PDB Compounds: (F:) Cytochrome b559 subunit beta

SCOPe Domain Sequences for d5ws6f_:

Sequence; same for both SEQRES and ATOM records:

>d5ws6f_ f.23.38.1 (F:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
sypiftvrwvavhtlavptifflgaiaamqfiqr

Timeline for d5ws6f_:

• d5ws6f_ first appeared in SCOPe 2.06
  
• d5ws6f_ appears in SCOPe 2.07