Lineage for d5ws6k_ (5ws6 K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026646Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 3026647Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 3026648Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 3026655Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries)
  8. 3026675Domain d5ws6k_: 5ws6 K: [331598]
    Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_
    automated match to d2axtk1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6k_

PDB Entry: 5ws6 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d5ws6k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws6k_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d5ws6k_:

Click to download the PDB-style file with coordinates for d5ws6k_.
(The format of our PDB-style files is described here.)

Timeline for d5ws6k_: