Lineage for d5ws6z_ (5ws6 z:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024237Superfamily f.17.5: PsbZ-like [161055] (2 families) (S)
    automatically mapped to Pfam PF01737
  5. 3024238Family f.17.5.1: PsbZ-like [161056] (1 protein)
    Pfam PF01737; Ycf9
  6. 3024239Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species)
  7. 3024250Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries)
  8. 3024273Domain d5ws6z_: 5ws6 z: [331499]
    Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_
    automated match to d4pj0z_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6z_

PDB Entry: 5ws6 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset
PDB Compounds: (z:) Photosystem II reaction center protein Z

SCOPe Domain Sequences for d5ws6z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws6z_ f.17.5.1 (z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]}
mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff
vv

SCOPe Domain Coordinates for d5ws6z_:

Click to download the PDB-style file with coordinates for d5ws6z_.
(The format of our PDB-style files is described here.)

Timeline for d5ws6z_: