![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.5: PsbZ-like [161055] (2 families) ![]() automatically mapped to Pfam PF01737 |
![]() | Family f.17.5.1: PsbZ-like [161056] (1 protein) Pfam PF01737; Ycf9 |
![]() | Protein Photosystem II reaction center protein Z, PsbZ [161057] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [192451] (30 PDB entries) |
![]() | Domain d5ws6z_: 5ws6 z: [331499] Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_ automated match to d4pj0z_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 5ws6 (more details), 2.35 Å
SCOPe Domain Sequences for d5ws6z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws6z_ f.17.5.1 (z:) Photosystem II reaction center protein Z, PsbZ {Thermosynechococcus vulcanus [TaxId: 32053]} mtilfqlalaalvilsfvmvigvpvayaspqdwdrskqliflgsglwialvlvvgvlnff vv
Timeline for d5ws6z_: