![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) ![]() automatically mapped to Pfam PF01788 |
![]() | Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
![]() | Protein automated matches [191002] (3 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries) |
![]() | Domain d5ws6j_: 5ws6 j: [331589] Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_ automated match to d5b5ej_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 5ws6 (more details), 2.35 Å
SCOPe Domain Sequences for d5ws6j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws6j_ f.23.32.1 (j:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} mseggriplwivatvagmgvivivglffygayaglgssl
Timeline for d5ws6j_: