SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ws6v_ (5ws6 V:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981026Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981027Protein automated matches [190453] (22 species)
    not a true protein
  7. 2286104Species Thermosynechococcus vulcanus [TaxId:32053] [329405] (5 PDB entries)
  8. 2288298Domain d5ws6v_: 5ws6 V: [331599]
    Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6x_, d5ws6z_
    automated match to d1e29a_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6v_

PDB Entry: 5ws6 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset
PDB Compounds: (V:) cytochrome c-550

SCOPe Domain Sequences for d5ws6v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws6v_ a.3.1.0 (V:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d5ws6v_:

Click to download the PDB-style file with coordinates for d5ws6v_.
(The format of our PDB-style files is described here.)

Timeline for d5ws6v_:

  • d5ws6v_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-17