Lineage for d5ws6i_ (5ws6 I:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2226297Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2227432Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) (S)
    automatically mapped to Pfam PF02532
  5. 2227433Family f.23.37.1: PsbI-like [161042] (1 protein)
    Pfam PF02532
  6. 2227434Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)
  7. 2227440Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (10 PDB entries)
  8. 2288295Domain d5ws6i_: 5ws6 I: [331596]
    Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6u_, d5ws6v_, d5ws6x_, d5ws6z_
    automated match to d4ub8i_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6i_

PDB Entry: 5ws6 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset
PDB Compounds: (I:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5ws6i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws6i_ f.23.37.1 (I:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]}
metlkitvyivvtffvllfvfgflsgdparnpkrkdle

SCOPe Domain Coordinates for d5ws6i_:

Click to download the PDB-style file with coordinates for d5ws6i_.
(The format of our PDB-style files is described here.)

Timeline for d5ws6i_:

  • d5ws6i_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-17