Lineage for d5ws6u_ (5ws6 U:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2716398Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2716633Family a.60.12.2: PsbU-like [158539] (2 proteins)
    Pfam PF06514
  6. 2716660Protein automated matches [191005] (3 species)
    not a true protein
  7. 2716670Species Thermosynechococcus vulcanus [TaxId:32053] [329396] (6 PDB entries)
  8. 2716675Domain d5ws6u_: 5ws6 U: [331585]
    Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6v_, d5ws6x_, d5ws6z_
    automated match to d2axtu1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl

Details for d5ws6u_

PDB Entry: 5ws6 (more details), 2.35 Å

PDB Description: native xfel structure of photosystem ii (preflash two-flash dataset
PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5ws6u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ws6u_ a.60.12.2 (U:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt
erqkqilrenlehftvtevetalveggdrynnglyk

SCOPe Domain Coordinates for d5ws6u_:

Click to download the PDB-style file with coordinates for d5ws6u_.
(The format of our PDB-style files is described here.)

Timeline for d5ws6u_: