Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
Protein automated matches [191005] (3 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [329396] (6 PDB entries) |
Domain d5ws6u_: 5ws6 U: [331585] Other proteins in same PDB: d5ws6a_, d5ws6b_, d5ws6c_, d5ws6d_, d5ws6e_, d5ws6f_, d5ws6h_, d5ws6i_, d5ws6j_, d5ws6k_, d5ws6l_, d5ws6m_, d5ws6o_, d5ws6t_, d5ws6v_, d5ws6x_, d5ws6z_ automated match to d2axtu1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, oey, pho, pl9, sqd, unl |
PDB Entry: 5ws6 (more details), 2.35 Å
SCOPe Domain Sequences for d5ws6u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ws6u_ a.60.12.2 (U:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} lvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipglt erqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d5ws6u_: