Lineage for d1keeg6 (1kee G:677-935)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137856Fold d.142: ATP-grasp [56058] (2 superfamilies)
  4. 137857Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 137877Family d.142.1.2: Biotin carboxylase/Carbamoyl phosphate synthetase [56067] (5 proteins)
  6. 137886Protein Carbamoyl phosphate synthetase (CPS), large subunit [56076] (1 species)
  7. 137887Species Escherichia coli [TaxId:562] [56077] (8 PDB entries)
  8. 137935Domain d1keeg6: 1kee G:677-935 [68521]
    Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keeb1, d1keeb2, d1keec1, d1keec2, d1keec3, d1keec4, d1keed1, d1keed2, d1keee1, d1keee2, d1keee3, d1keee4, d1keef1, d1keef2, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeh1, d1keeh2

Details for d1keeg6

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: Inactivation of the Amidotransferase Activity of Carbamoyl Phosphate Synthetase by the Antibiotic Acivicin

SCOP Domain Sequences for d1keeg6:

Sequence, based on SEQRES records: (download)

>d1keeg6 d.142.1.2 (G:677-935) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpsyvlggrameivydeadlrr
yfqtavsvsndapvlldhflddavevdvdaicdgemvliggimehieqagvhsgdsacsl
paytlsqeiqdvmrqqvqklafelqvrglmnvqfavknnevylievnpraartvpfvska
tgvplakvaarvmagkslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstge
vmgvgrtfaeafakaqlgs

Sequence, based on observed residues (ATOM records): (download)

>d1keeg6 d.142.1.2 (G:677-935) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
rfqhaverlklkqpanatvtaiemavekakeigyplvvrpameivydeadlrryfqtavl
ldhflddavevdvdaicdgemvliggimehieqagvhsgdsacslpaytlsqeiqdvmrq
qvqklafelqvrglmnvqfavknnevylievnpraartvpfvskatgvplakvaarvmag
kslaeqgvtkevippyysvkevvlpfnkfpgvdpllgpemrstgevmgvgrtfaeafaka
qlgs

SCOP Domain Coordinates for d1keeg6:

Click to download the PDB-style file with coordinates for d1keeg6.
(The format of our PDB-style files is described here.)

Timeline for d1keeg6: