Lineage for d1keeb1 (1kee B:2-152)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119570Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 119616Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 119617Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 119618Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 119619Species Escherichia coli [TaxId:562] [52024] (8 PDB entries)
  8. 119640Domain d1keeb1: 1kee B:2-152 [68498]
    Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb2, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed2, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef2, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh2

Details for d1keeb1

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keeb1 c.8.3.1 (B:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOP Domain Coordinates for d1keeb1:

Click to download the PDB-style file with coordinates for d1keeb1.
(The format of our PDB-style files is described here.)

Timeline for d1keeb1: