Lineage for d1keea1 (1kee A:403-555)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 99608Fold a.92: Carbamoyl phosphate synthetase, large subunit connection domain [48107] (1 superfamily)
  4. 99609Superfamily a.92.1: Carbamoyl phosphate synthetase, large subunit connection domain [48108] (1 family) (S)
  5. 99610Family a.92.1.1: Carbamoyl phosphate synthetase, large subunit connection domain [48109] (1 protein)
  6. 99611Protein Carbamoyl phosphate synthetase, large subunit connection domain [48110] (1 species)
  7. 99612Species Escherichia coli [TaxId:562] [48111] (8 PDB entries)
  8. 99633Domain d1keea1: 1kee A:403-555 [68492]
    Other proteins in same PDB: d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keeb2, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keed2, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1, d1keeh2

Details for d1keea1

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keea1 a.92.1.1 (A:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1keea1:

Click to download the PDB-style file with coordinates for d1keea1.
(The format of our PDB-style files is described here.)

Timeline for d1keea1: