Lineage for d1keee2 (1kee E:936-1073)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120916Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
  4. 120917Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
  5. 120918Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 120919Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 120920Species Escherichia coli [TaxId:562] [52338] (8 PDB entries)
  8. 120943Domain d1keee2: 1kee E:936-1073 [68509]
    Other proteins in same PDB: d1keea1, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keeb2, d1keec1, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keed2, d1keee1, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg1, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1, d1keeh2

Details for d1keee2

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keee2 c.24.1.1 (E:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1keee2:

Click to download the PDB-style file with coordinates for d1keee2.
(The format of our PDB-style files is described here.)

Timeline for d1keee2: