| Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
| Fold c.23: Flavodoxin-like [52171] (17 superfamilies) |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) ![]() |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (4 proteins) |
| Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species) |
| Species Escherichia coli [TaxId:562] [52322] (8 PDB entries) |
| Domain d1keed2: 1kee D:153-380 [68507] Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1 |
PDB Entry: 1kee (more details), 2.1 Å
SCOP Domain Sequences for d1keed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1keed2 c.23.16.1 (D:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt
Timeline for d1keed2:
View in 3DDomains from other chains: (mouse over for more information) d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keeb2, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1, d1keeh2 |