Lineage for d1keed2 (1kee D:153-380)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120799Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families) (S)
  5. 120800Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (4 proteins)
  6. 120811Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)
  7. 120812Species Escherichia coli [TaxId:562] [52322] (8 PDB entries)
  8. 120834Domain d1keed2: 1kee D:153-380 [68507]
    Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1

Details for d1keed2

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keed2 c.23.16.1 (D:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

SCOP Domain Coordinates for d1keed2:

Click to download the PDB-style file with coordinates for d1keed2.
(The format of our PDB-style files is described here.)

Timeline for d1keed2: