SCOP 1.59: Domain d1keeb2: 1kee B:153-380

Lineage for d1keeb2 (1kee B:153-380)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.23: Flavodoxin-like [52171] (17 superfamilies)

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (4 families)

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (4 proteins)

6. Protein Carbamoyl phosphate synthetase, small subunit C-terminal domain [52321] (1 species)

7. Species Escherichia coli [TaxId:562] [52322] (8 PDB entries)

8. Domain d1keeb2: 1kee B:153-380 [68499]
   Other proteins in same PDB: d1keea1, d1keea2, d1keea3, d1keea4, d1keea5, d1keea6, d1keeb1, d1keec1, d1keec2, d1keec3, d1keec4, d1keec5, d1keec6, d1keed1, d1keee1, d1keee2, d1keee3, d1keee4, d1keee5, d1keee6, d1keef1, d1keeg1, d1keeg2, d1keeg3, d1keeg4, d1keeg5, d1keeg6, d1keeh1

Details for d1keeb2

PDB Entry: 1kee, 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keeb2:

Sequence; same for both SEQRES and ATOM records:

>d1keeb2 c.23.16.1 (B:153-380) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli}
lngmdlakevttaeayswtqgswtltgglpeakkedelpfhvvaydfgakrnilrmlvdr
gcrltivpaqtsaedvlkmnpdgiflsngpgdpapcdyaitaiqkfletdipvfgiclgh
qllalasgaktvkmkfghhggnhpvkdveknvvmitaqnhgfavdeatlpanlrvthksl
fdgtlqgihrtdkpafsfqghpeaspgphdaaplfdhfielieqyrkt

Timeline for d1keeb2:

• d1keeb2 is new in SCOP 1.59
  
• d1keeb2 appears in SCOP 1.61
  
• d1keeb2 appears in the current release, SCOPe 2.08