SCOP 1.59: Domain d1keea3: 1kee A:1-127

Lineage for d1keea3 (1kee A:1-127)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)

4. Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families)

5. Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)

6. Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)

7. Species Escherichia coli [TaxId:562] [52451] (8 PDB entries)

8. Domain d1keea3: 1kee A:1-127 [68494]
   Other proteins in same PDB: d1keea1, d1keea2, d1keea5, d1keea6, d1keeb1, d1keeb2, d1keec1, d1keec2, d1keec5, d1keec6, d1keed1, d1keed2, d1keee1, d1keee2, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg1, d1keeg2, d1keeg5, d1keeg6, d1keeh1, d1keeh2

Details for d1keea3

PDB Entry: 1kee, 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keea3:

Sequence; same for both SEQRES and ATOM records:

>d1keea3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

Timeline for d1keea3:

• d1keea3 is new in SCOP 1.59
  
• d1keea3 appears in SCOP 1.61
  
• d1keea3 appears in the current release, SCOPe 2.08