Details for d1keeg1

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: Inactivation of the Amidotransferase Activity of Carbamoyl Phosphate Synthetase by the Antibiotic Acivicin

SCOP Domain Sequences for d1keeg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keeg1 a.92.1.1 (G:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1keeg1:

Click to download the PDB-style file with coordinates for d1keeg1.
(The format of our PDB-style files is described here.)

Timeline for d1keeg1: