Lineage for d1keeg3 (1kee G:1-127)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121291Fold c.30: Biotin carboxylase N-terminal domain-like [52439] (1 superfamily)
  4. 121292Superfamily c.30.1: Biotin carboxylase N-terminal domain-like [52440] (5 families) (S)
  5. 121293Family c.30.1.1: Biotin carboxylase/Carbamoyl phosphate synthetase [52441] (5 proteins)
  6. 121302Protein Carbamoyl phosphate synthetase (CPS), large subunit [52450] (1 species)
  7. 121303Species Escherichia coli [TaxId:562] [52451] (8 PDB entries)
  8. 121350Domain d1keeg3: 1kee G:1-127 [68518]
    Other proteins in same PDB: d1keea1, d1keea2, d1keea5, d1keea6, d1keeb1, d1keeb2, d1keec1, d1keec2, d1keec5, d1keec6, d1keed1, d1keed2, d1keee1, d1keee2, d1keee5, d1keee6, d1keef1, d1keef2, d1keeg1, d1keeg2, d1keeg5, d1keeg6, d1keeh1, d1keeh2

Details for d1keeg3

PDB Entry: 1kee (more details), 2.1 Å

PDB Description: inactivation of the amidotransferase activity of carbamoyl phosphate synthetase by the antibiotic acivicin

SCOP Domain Sequences for d1keeg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keeg3 c.30.1.1 (G:1-127) Carbamoyl phosphate synthetase (CPS), large subunit {Escherichia coli}
mpkrtdiksililgagpivigqacefdysgaqackalreegyrvilvnsnpatimtdpem
adatyiepihwevvrkiiekerpdavlptmggqtalncalelerqgvleefgvtmigata
daidkae

SCOP Domain Coordinates for d1keeg3:

Click to download the PDB-style file with coordinates for d1keeg3.
(The format of our PDB-style files is described here.)

Timeline for d1keeg3: