Lineage for d2vz8aa (2vz8 A:1524-1637,A:1823-1876)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841291Protein Enoylreductase substrate-binding domain from fatty acid synthase (FAS) [419110] (1 species)
  7. 2841292Species Pig (Sus scrofa) [TaxId:9823] [419628] (1 PDB entry)
  8. 2841293Domain d2vz8aa: 2vz8 A:1524-1637,A:1823-1876 [412993]
    Other proteins in same PDB: d2vz8a1, d2vz8a2, d2vz8a3, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a7, d2vz8a8, d2vz8a9, d2vz8ab, d2vz8ac, d2vz8ad

Details for d2vz8aa

PDB Entry: 2vz8 (more details), 3.2 Å

PDB Description: crystal structure of mammalian fatty acid synthase
PDB Compounds: (A:) fatty acid synthase

SCOPe Domain Sequences for d2vz8aa:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vz8aa c.2.1.1 (A:1524-1637,A:1823-1876) Enoylreductase substrate-binding domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]}
pekqtehafvnvlsrgdlssirwvcsplhyalpascqdrlcsvyytslnfrdvmlatgkl
spdsipgkwltrdcmlgmefsgrdasgrrvmgmvpaeglatsvlllqhatwevpXvqplk
ctvfprtkveaafrymaqgkhigkvviqvreeeqgpaprglppialtgl

SCOPe Domain Coordinates for d2vz8aa:

Click to download the PDB-style file with coordinates for d2vz8aa.
(The format of our PDB-style files is described here.)

Timeline for d2vz8aa:

  • d2vz8aa is new in SCOPe 2.08-stable