Lineage for d2vz8ad (2vz8 A:1408-1523)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842611Protein Ketoreductase domain from fatty acid synthase (FAS) [419112] (1 species)
    tandem repeat of two SDR-like modules resembling a dimer commonly found in the family; only the second module retains the coenzyme-binding site
  7. 2842612Species Pig (Sus scrofa) [TaxId:9823] [419630] (1 PDB entry)
  8. 2842614Domain d2vz8ad: 2vz8 A:1408-1523 [412996]
    Other proteins in same PDB: d2vz8a1, d2vz8a2, d2vz8a3, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a7, d2vz8a8, d2vz8a9, d2vz8aa, d2vz8ab

Details for d2vz8ad

PDB Entry: 2vz8 (more details), 3.2 Å

PDB Description: crystal structure of mammalian fatty acid synthase
PDB Compounds: (A:) fatty acid synthase

SCOPe Domain Sequences for d2vz8ad:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vz8ad c.2.1.2 (A:1408-1523) Ketoreductase domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]}
tpqdspvflsvedtsfrwvdslkdiladassrpvwlmavgcstsgvvgmvnclrkepggh
rircvlvsnlsstspapemhpssselqkvlqgdlvmnvyrdgawgafrhfpleqdr

SCOPe Domain Coordinates for d2vz8ad:

Click to download the PDB-style file with coordinates for d2vz8ad.
(The format of our PDB-style files is described here.)

Timeline for d2vz8ad:

  • d2vz8ad is new in SCOPe 2.08-stable