Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Ketoreductase domain from fatty acid synthase (FAS) [419112] (1 species) tandem repeat of two SDR-like modules resembling a dimer commonly found in the family; only the second module retains the coenzyme-binding site |
Species Pig (Sus scrofa) [TaxId:9823] [419630] (1 PDB entry) |
Domain d2vz8ad: 2vz8 A:1408-1523 [412996] Other proteins in same PDB: d2vz8a1, d2vz8a2, d2vz8a3, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a7, d2vz8a8, d2vz8a9, d2vz8aa, d2vz8ab |
PDB Entry: 2vz8 (more details), 3.2 Å
SCOPe Domain Sequences for d2vz8ad:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vz8ad c.2.1.2 (A:1408-1523) Ketoreductase domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]} tpqdspvflsvedtsfrwvdslkdiladassrpvwlmavgcstsgvvgmvnclrkepggh rircvlvsnlsstspapemhpssselqkvlqgdlvmnvyrdgawgafrhfpleqdr
Timeline for d2vz8ad: