Lineage for d2vz8a9 (2vz8 A:1112-1407)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894464Family c.66.1.62: pseudo-methyltransferase domain from fatty acid synthase (FAS) [418805] (1 protein)
    Pfam PF08242
    Pfam PF01611
  6. 2894465Protein pseudo-methyltransferase domain from fatty acid synthase (FAS) [419109] (1 species)
    probably non-catalytic and inactive, according to PubMed 18772430
  7. 2894466Species Pig (Sus scrofa) [TaxId:9823] [419627] (1 PDB entry)
  8. 2894467Domain d2vz8a9: 2vz8 A:1112-1407 [412992]
    Other proteins in same PDB: d2vz8a1, d2vz8a2, d2vz8a3, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a7, d2vz8a8, d2vz8aa, d2vz8ab, d2vz8ac, d2vz8ad

Details for d2vz8a9

PDB Entry: 2vz8 (more details), 3.2 Å

PDB Description: crystal structure of mammalian fatty acid synthase
PDB Compounds: (A:) fatty acid synthase

SCOPe Domain Sequences for d2vz8a9:

Sequence, based on SEQRES records: (download)

>d2vz8a9 c.66.1.62 (A:1112-1407) pseudo-methyltransferase domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]}
lkpilekfcftphvesgclagntalqeelqlcrglaqalqtkvaqqglkmvvpgldgaqa
preapqqslprllaaacqlqlngnlqlelgqvlaqerpllcddpllsglldapalkacvd
talenmaspkmkvvevlagdgqlysripallntqpvmdldytatdrnpqaleaaqakleq
lhvtqgqwdpanpapgslgkadllvcncalatlgdpavavgnmaatlkeggflllhtlla
ghplgemvgfltspeqggrhllsqdqweslfagaslhlvalkrsfygsvlflcrqq

Sequence, based on observed residues (ATOM records): (download)

>d2vz8a9 c.66.1.62 (A:1112-1407) pseudo-methyltransferase domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]}
lkpilekfcftphvesgclagntallsglldapalkacvdtalenmaspkmkvvevlagd
gqlysripallntqpvmdldytatdrnpqaleaaqakleqlhvtqgqwdpanpapadllv
cncaggflllhtldqweslfagaslhlvalkrsfygsvlflcrqq

SCOPe Domain Coordinates for d2vz8a9:

Click to download the PDB-style file with coordinates for d2vz8a9.
(The format of our PDB-style files is described here.)

Timeline for d2vz8a9:

  • d2vz8a9 is new in SCOPe 2.08-stable