![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest |
![]() | Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) ![]() |
![]() | Family c.19.1.1: FabD-like [52152] (4 proteins) the superfamily common core covers almost all of the family fold |
![]() | Protein Ferredoxin-like domain from acyl transferase MAT [310772] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [419622] (1 PDB entry) |
![]() | Domain d2vz8a3: 2vz8 A:618-678 [412986] Other proteins in same PDB: d2vz8a1, d2vz8a2, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a7, d2vz8a8, d2vz8a9, d2vz8aa, d2vz8ab, d2vz8ac, d2vz8ad fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2vz8 (more details), 3.2 Å
SCOPe Domain Sequences for d2vz8a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vz8a3 c.19.1.1 (A:618-678) Ferredoxin-like domain from acyl transferase MAT {Pig (Sus scrofa) [TaxId: 9823]} gamaavglsweeckqrcppgivpachnskdtvtisgpqaamseflqqlkredvfvkevrt g
Timeline for d2vz8a3: