Lineage for d2vz8a3 (2vz8 A:618-678)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855172Fold c.19: FabD/lysophospholipase-like [52150] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 432156; strand 4 is antiparallel to the rest
  4. 2855173Superfamily c.19.1: FabD/lysophospholipase-like [52151] (3 families) (S)
  5. 2855174Family c.19.1.1: FabD-like [52152] (4 proteins)
    the superfamily common core covers almost all of the family fold
  6. 2855196Protein Ferredoxin-like domain from acyl transferase MAT [310772] (2 species)
  7. 2855202Species Pig (Sus scrofa) [TaxId:9823] [419622] (1 PDB entry)
  8. 2855203Domain d2vz8a3: 2vz8 A:618-678 [412986]
    Other proteins in same PDB: d2vz8a1, d2vz8a2, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a7, d2vz8a8, d2vz8a9, d2vz8aa, d2vz8ab, d2vz8ac, d2vz8ad
    fragment; missing more than one-third of the common structure and/or sequence

Details for d2vz8a3

PDB Entry: 2vz8 (more details), 3.2 Å

PDB Description: crystal structure of mammalian fatty acid synthase
PDB Compounds: (A:) fatty acid synthase

SCOPe Domain Sequences for d2vz8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vz8a3 c.19.1.1 (A:618-678) Ferredoxin-like domain from acyl transferase MAT {Pig (Sus scrofa) [TaxId: 9823]}
gamaavglsweeckqrcppgivpachnskdtvtisgpqaamseflqqlkredvfvkevrt
g

SCOPe Domain Coordinates for d2vz8a3:

Click to download the PDB-style file with coordinates for d2vz8a3.
(The format of our PDB-style files is described here.)

Timeline for d2vz8a3:

  • d2vz8a3 is new in SCOPe 2.08-stable