Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
Protein Ketoacyl synthase domain from fatty acid synthase (FAS) [419107] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [419621] (1 PDB entry) |
Domain d2vz8a2: 2vz8 A:238-411 [412985] Other proteins in same PDB: d2vz8a3, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a7, d2vz8a8, d2vz8a9, d2vz8aa, d2vz8ab, d2vz8ac, d2vz8ad |
PDB Entry: 2vz8 (more details), 3.2 Å
SCOPe Domain Sequences for d2vz8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vz8a2 c.95.1.1 (A:238-411) Ketoacyl synthase domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]} larrvyatilnagtntdgskeqgvtfpsgdvqeqlirslyapagpdpesleyieahgtgt kvgdpqelngivnalcatrreplligstksnmghpepasgvaalikvllslehgvwapnl hyhtpnpeipalqdgrlqvvdrplpirggnvginsfgfggsnvhvilqpnsrpa
Timeline for d2vz8a2: