Lineage for d2vz8a2 (2vz8 A:238-411)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916894Protein Ketoacyl synthase domain from fatty acid synthase (FAS) [419107] (1 species)
  7. 2916895Species Pig (Sus scrofa) [TaxId:9823] [419621] (1 PDB entry)
  8. 2916897Domain d2vz8a2: 2vz8 A:238-411 [412985]
    Other proteins in same PDB: d2vz8a3, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a7, d2vz8a8, d2vz8a9, d2vz8aa, d2vz8ab, d2vz8ac, d2vz8ad

Details for d2vz8a2

PDB Entry: 2vz8 (more details), 3.2 Å

PDB Description: crystal structure of mammalian fatty acid synthase
PDB Compounds: (A:) fatty acid synthase

SCOPe Domain Sequences for d2vz8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vz8a2 c.95.1.1 (A:238-411) Ketoacyl synthase domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]}
larrvyatilnagtntdgskeqgvtfpsgdvqeqlirslyapagpdpesleyieahgtgt
kvgdpqelngivnalcatrreplligstksnmghpepasgvaalikvllslehgvwapnl
hyhtpnpeipalqdgrlqvvdrplpirggnvginsfgfggsnvhvilqpnsrpa

SCOPe Domain Coordinates for d2vz8a2:

Click to download the PDB-style file with coordinates for d2vz8a2.
(The format of our PDB-style files is described here.)

Timeline for d2vz8a2:

  • d2vz8a2 is new in SCOPe 2.08-stable