Lineage for d2vz8a7 (2vz8 A:858-979)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944307Family d.38.1.9: Polyketide synthase dehydratase (PS-DH)-like [418804] (1 protein)
    Pfam PF14765; duplication: consists of two 4HBT-like domains
  6. 2944308Protein Dehydratase domain from fatty acid synthase (FAS) [419108] (1 species)
    only the second domain has catalytic residues
  7. 2944309Species Pig (Sus scrofa) [TaxId:9823] [419626] (1 PDB entry)
  8. 2944310Domain d2vz8a7: 2vz8 A:858-979 [412990]
    Other proteins in same PDB: d2vz8a1, d2vz8a2, d2vz8a3, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a9, d2vz8aa, d2vz8ab, d2vz8ac, d2vz8ad

Details for d2vz8a7

PDB Entry: 2vz8 (more details), 3.2 Å

PDB Description: crystal structure of mammalian fatty acid synthase
PDB Compounds: (A:) fatty acid synthase

SCOPe Domain Sequences for d2vz8a7:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vz8a7 d.38.1.9 (A:858-979) Dehydratase domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]}
svavykfdvspespdhylvdhcidgrvlfpgtgylwltwktlaralsqnleetpvvfedv
tlhqatilpktgtvslevrlleashafevsdsngsliasgkvyqwespdpklfdtraavd
pa

SCOPe Domain Coordinates for d2vz8a7:

Click to download the PDB-style file with coordinates for d2vz8a7.
(The format of our PDB-style files is described here.)

Timeline for d2vz8a7:

  • d2vz8a7 is new in SCOPe 2.08-stable