SCOPe 2.08: Domain d2vz8ac: 2vz8 A:1877-2113

Lineage for d2vz8ac (2vz8 A:1877-2113)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Ketoreductase domain from fatty acid synthase (FAS) [419112] (1 species)
   tandem repeat of two SDR-like modules resembling a dimer commonly found in the family; only the second module retains the coenzyme-binding site

7. Species Pig (Sus scrofa) [TaxId:9823] [419630] (1 PDB entry)

8. Domain d2vz8ac: 2vz8 A:1877-2113 [412995]
   Other proteins in same PDB: d2vz8a1, d2vz8a2, d2vz8a3, d2vz8a4, d2vz8a5, d2vz8a6, d2vz8a7, d2vz8a8, d2vz8a9, d2vz8aa, d2vz8ab

Details for d2vz8ac

PDB Entry: 2vz8, 3.2 Å

PDB Description: crystal structure of mammalian fatty acid synthase

PDB Compounds: (A:) fatty acid synthase

SCOPe Domain Sequences for d2vz8ac:

Sequence, based on SEQRES records:

>d2vz8ac c.2.1.2 (A:1877-2113) Ketoreductase domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]}
sktfcpphksyvitgglggfglqlaqwlrlrgaqklvltsrsgirtgyqarqvrewrrqg
vqvlvstsnassldgarsliteatqlgpvggvfnlamvlrdavlenqtpeffqdvskpky
sgtanldrvtreacpeldyfvifssvscgrgnagqanygfansamericekrrhdglpgl
avqwgaigdvgvvletmgtndtviggtlpqriasclevldlflsqphpvlssfvlae

Sequence, based on observed residues (ATOM records):

>d2vz8ac c.2.1.2 (A:1877-2113) Ketoreductase domain from fatty acid synthase (FAS) {Pig (Sus scrofa) [TaxId: 9823]}
sktfcpphksyvitgglggfglqlaqwlrlrgaqklvltsrsgirtgyqarqvrewrrqg
vqvlvstsnassldgarsliteatqlgpvggvfnlamvvskpkysgtanldrvtreacpe
ldyfvifssvscgrgnagqanygfansamericekrrhdglpglavqwgaigdvgvvlen
dtviggtlpqriasclevldlflsqphpvlssfvlae

Timeline for d2vz8ac:

• d2vz8ac is new in SCOPe 2.08-stable