![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
![]() | Protein Sigma70 (SigA, RpoD) [88666] (4 species) Pfam PF03979 |
![]() | Species Thermus thermophilus [TaxId:274] [88667] (11 PDB entries) Uniprot Q9WX78 |
![]() | Domain d6cuuf3: 6cuu F:319-423 [355108] Other proteins in same PDB: d6cuua1, d6cuua2, d6cuub1, d6cuub2, d6cuuc_, d6cuud_, d6cuue_, d6cuuf1, d6cuuf2 automated match to d1smyf2 protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn |
PDB Entry: 6cuu (more details), 2.99 Å
SCOPe Domain Sequences for d6cuuf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cuuf3 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
Timeline for d6cuuf3: