Lineage for d6cuuf3 (6cuu F:319-423)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695832Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2695870Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 2695878Protein Sigma70 (SigA, RpoD) [88666] (4 species)
    Pfam PF03979
  7. 2695892Species Thermus thermophilus [TaxId:274] [88667] (11 PDB entries)
    Uniprot Q9WX78
  8. 2695910Domain d6cuuf3: 6cuu F:319-423 [355108]
    Other proteins in same PDB: d6cuua1, d6cuua2, d6cuub1, d6cuub2, d6cuuc_, d6cuud_, d6cuue_, d6cuuf1, d6cuuf2
    automated match to d1smyf2
    protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn

Details for d6cuuf3

PDB Entry: 6cuu (more details), 2.99 Å

PDB Description: thermus thermophiles rna polymerase in complex with promoter dna and antibiotic kanglemycin a
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d6cuuf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cuuf3 a.4.13.2 (F:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]}
tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg
rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld

SCOPe Domain Coordinates for d6cuuf3:

Click to download the PDB-style file with coordinates for d6cuuf3.
(The format of our PDB-style files is described here.)

Timeline for d6cuuf3: