Lineage for d6cuuc_ (6cuu C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 proteins)
  6. 2574291Protein RNA-polymerase beta [64488] (2 species)
  7. 2574297Species Thermus thermophilus [TaxId:274] [75609] (10 PDB entries)
    Uniprot Q8RQE9; part of multichain biological unit
  8. 3055339Domain d6cuuc_: 6cuu C: [355401]
    Other proteins in same PDB: d6cuua1, d6cuua2, d6cuub1, d6cuub2, d6cuud_, d6cuue_, d6cuuf1, d6cuuf2, d6cuuf3
    automated match to d1smyc_
    protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn

Details for d6cuuc_

PDB Entry: 6cuu (more details), 2.99 Å

PDB Description: thermus thermophiles rna polymerase in complex with promoter dna and antibiotic kanglemycin a
PDB Compounds: (C:) DNA-directed RNA polymerase subunit beta

SCOPe Domain Sequences for d6cuuc_:

Sequence, based on SEQRES records: (download)

>d6cuuc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglask

Sequence, based on observed residues (ATOM records): (download)

>d6cuuc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeglvl
dfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgs
fiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkv
nkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlftllrpgd
ppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkdevflpt
lrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrermlmgseds
ltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltreragfd
vrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdevvym
tateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnl
ipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakv
dgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengfl
algqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperitrdi
phlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifgekardvk
dtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdklanrhgnk
gvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryispif
dgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkel
flqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaq
fggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfr
vlvkelqalaldvqtldekdnpvdifeglask

SCOPe Domain Coordinates for d6cuuc_:

Click to download the PDB-style file with coordinates for d6cuuc_.
(The format of our PDB-style files is described here.)

Timeline for d6cuuc_: