Lineage for d6cuue_ (6cuu E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2340360Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2340361Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2340362Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 2340403Protein automated matches [257263] (3 species)
    not a true protein
  7. 3055040Species Thermus thermophilus [TaxId:262724] [355102] (1 PDB entry)
  8. 3055041Domain d6cuue_: 6cuu E: [355103]
    Other proteins in same PDB: d6cuua1, d6cuua2, d6cuub1, d6cuub2, d6cuuc_, d6cuud_, d6cuuf1, d6cuuf2, d6cuuf3
    automated match to d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn

Details for d6cuue_

PDB Entry: 6cuu (more details), 2.99 Å

PDB Description: thermus thermophiles rna polymerase in complex with promoter dna and antibiotic kanglemycin a
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d6cuue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cuue_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 262724]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

SCOPe Domain Coordinates for d6cuue_:

Click to download the PDB-style file with coordinates for d6cuue_.
(The format of our PDB-style files is described here.)

Timeline for d6cuue_: