SCOPe 2.08: Domain d6cuue_: 6cuu E:

Lineage for d6cuue_ (6cuu E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
   4 helices; irregular array

6. Protein automated matches [257263] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [355102] (1 PDB entry)

8. Domain d6cuue_: 6cuu E: [355103]
   Other proteins in same PDB: d6cuua1, d6cuua2, d6cuub1, d6cuub2, d6cuuc_, d6cuud_, d6cuuf1, d6cuuf2, d6cuuf3
   automated match to d1i6ve_
   protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn

Details for d6cuue_

PDB Entry: 6cuu, 2.99 Å

PDB Description: thermus thermophiles rna polymerase in complex with promoter dna and antibiotic kanglemycin a

PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d6cuue_:

Sequence; same for both SEQRES and ATOM records:

>d6cuue_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 262724]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

Timeline for d6cuue_:

• d6cuue_ first appeared in SCOPe 2.07