SCOPe 2.08: Domain d6cuua2: 6cuu A:50-172

Lineage for d6cuua2 (6cuu A:50-172)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)

6. Protein RNA polymerase alpha subunit [56555] (3 species)

7. Species Thermus thermophilus [TaxId:274] [75595] (16 PDB entries)
   Uniprot Q9Z9H6; part of multichain biological unit

8. Domain d6cuua2: 6cuu A:50-172 [355232]
   Other proteins in same PDB: d6cuua1, d6cuub1, d6cuuc_, d6cuud_, d6cuue_, d6cuuf1, d6cuuf2, d6cuuf3
   automated match to d1smya2
   protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn

Details for d6cuua2

PDB Entry: 6cuu, 2.99 Å

PDB Description: thermus thermophiles rna polymerase in complex with promoter dna and antibiotic kanglemycin a

PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d6cuua2:

Sequence; same for both SEQRES and ATOM records:

>d6cuua2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

Timeline for d6cuua2:

• d6cuua2 first appeared in SCOPe 2.07