Lineage for d6cuua1 (6cuu A:4-49,A:173-230)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2524493Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2524624Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2524625Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2524626Protein RNA polymerase alpha [55259] (3 species)
  7. 2524641Species Thermus thermophilus [TaxId:274] [75478] (16 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 3055169Domain d6cuua1: 6cuu A:4-49,A:173-230 [355231]
    Other proteins in same PDB: d6cuua2, d6cuub2, d6cuuc_, d6cuud_, d6cuue_, d6cuuf1, d6cuuf2, d6cuuf3
    automated match to d1smya1
    protein/DNA complex; protein/RNA complex; complexed with kng, mg, zn

Details for d6cuua1

PDB Entry: 6cuu (more details), 2.99 Å

PDB Description: thermus thermophiles rna polymerase in complex with promoter dna and antibiotic kanglemycin a
PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d6cuua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cuua1 d.74.3.1 (A:4-49,A:173-230) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
sklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtr
lgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqa

SCOPe Domain Coordinates for d6cuua1:

Click to download the PDB-style file with coordinates for d6cuua1.
(The format of our PDB-style files is described here.)

Timeline for d6cuua1: