SCOPe 2.08: Domain d3iasl1: 3ias L:1-95

Lineage for d3iasl1 (3ias L:1-95)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (24 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255888] (3 PDB entries)

8. Domain d3iasl1: 3ias L:1-95 [246873]
   Other proteins in same PDB: d3ias11, d3ias12, d3ias13, d3ias2_, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_
   automated match to d2fug33
   complexed with ca, fes, fmn, sf4

Details for d3iasl1

PDB Entry: 3ias, 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution

PDB Compounds: (L:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3iasl1:

Sequence, based on SEQRES records:

>d3iasl1 d.15.4.0 (L:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
gkpllnekgepeiqwqpklaascvtavadgmvvdt

Sequence, based on observed residues (ATOM records):

>d3iasl1 d.15.4.0 (L:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
klaascvtavadgmvvdt

Timeline for d3iasl1:

• d3iasl1 first appeared in SCOPe 2.04
  
• d3iasl1 appears in SCOPe 2.07